DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysS and CG16799

DIOPT Version :9

Sequence 1:NP_476829.1 Gene:LysS / 38130 FlyBaseID:FBgn0004430 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001286641.1 Gene:CG16799 / 37340 FlyBaseID:FBgn0034538 Length:179 Species:Drosophila melanogaster


Alignment Length:136 Identity:38/136 - (27%)
Similarity:65/136 - (47%) Gaps:10/136 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFF-----ALVLLAIAAPALAGRTLDRCSLAREMAD-LGVPRDQLDKWTCIAQHESDYRTWVV 59
            ||.|.     .|:||.:....:..:...||.|.|.:.: ....:..:..|.|:.:|||...|..|
  Fly    17 MKTFCLWIVPVLILLQLGIEQVESKKYQRCELTRVLVENYNFDKTFISNWICLVEHESYLDTTKV 81

  Fly    60 GPANSDGSNDYGIFQINDLYWCQADGRFSYNECGLSCNALLTDDITNSVRCAQKVLSQQGWSAWA 124
            ....::..| ||:||||...:| ::|| ...:|.:.|.....|||::.:.||:.:..::|:..|.
  Fly    82 TKKGNESKN-YGLFQINSKDYC-SEGR-KGGQCNMKCEDFSNDDISDDIACARMIQEREGFKYWK 143

  Fly   125 VW-HYC 129
            .| .:|
  Fly   144 GWDRFC 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysSNP_476829.1 LYZ1 20..140 CDD:197612 32/112 (29%)
CG16799NP_001286641.1 LYZ1 41..162 CDD:238066 32/112 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458900
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6956
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
76.800

Return to query results.
Submit another query.