DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysS and RGD1306474

DIOPT Version :9

Sequence 1:NP_476829.1 Gene:LysS / 38130 FlyBaseID:FBgn0004430 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001102216.1 Gene:RGD1306474 / 362881 RGDID:1306474 Length:151 Species:Rattus norvegicus


Alignment Length:137 Identity:50/137 - (36%)
Similarity:73/137 - (53%) Gaps:15/137 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAF-----FALVLLAIAAPALAGRTLDRCSLAREMADLGV---PRDQLDKWTCIAQHESDYRTW 57
            |||.     ..|:||:|   .:.|:.|:||.|||.:...|:   ....|..|.|:|:..|.|.|.
  Rat     1 MKALPTLLTLGLLLLSI---TVQGKVLNRCLLARTLQRFGLGGFKGISLANWICLAKSVSGYDTK 62

  Fly    58 VVGPANSDGSNDYGIFQINDLYWCQADGRF--SYNECGLSCNALLTDDITNSVRCAQKVLSQ-QG 119
            .:...:.|.|.:||||||:..|||. |.:.  |.|.|.:||.|||.::|..||.||::::.. :|
  Rat    63 AIKYNHEDRSTNYGIFQISSRYWCN-DSKTPGSKNFCRVSCKALLKNNIKASVTCAKRIVKDPRG 126

  Fly   120 WSAWAVW 126
            .:.|..|
  Rat   127 ITTWEAW 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysSNP_476829.1 LYZ1 20..140 CDD:197612 42/113 (37%)
RGD1306474NP_001102216.1 LYZ1 22..149 CDD:197612 42/113 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347535
Domainoid 1 1.000 106 1.000 Domainoid score I6429
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I4799
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8912
orthoMCL 1 0.900 - - OOG6_107030
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.