DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysS and Spaca5

DIOPT Version :10

Sequence 1:NP_476829.1 Gene:LysS / 38130 FlyBaseID:FBgn0004430 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001101528.1 Gene:Spaca5 / 314431 RGDID:1584964 Length:160 Species:Rattus norvegicus


Alignment Length:147 Identity:49/147 - (33%)
Similarity:77/147 - (52%) Gaps:14/147 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FFALVLLAIAAPALA---GRTLDRCSLAREMADLGVPRDQ---LDKWTCIAQHESDYRTWVVGPA 62
            |.:.|::.:|...||   .:..:||.|||::...|:...:   :..|.|:|.:||.:.|..| ..
  Rat     3 FCSTVVVILATLLLATVDAKIYERCELARKLEKAGLNGFKGYTVGDWLCVAHYESGFDTSFV-DH 66

  Fly    63 NSDGSNDYGIFQINDLYWCQADGRFSYNECGLSCNALLTDDITNSVRCAQKVL-SQQGWSAWAVW 126
            |.|||::|||||:|..:||......:.|.|.:.||.||...|.:.:.||::|: |.:...||..|
  Rat    67 NPDGSSEYGIFQLNSAWWCNNGITPTQNLCHMDCNDLLNRHILDDIMCAKRVVSSHKSMKAWDSW 131

  Fly   127 -HYCSG-----WLPSID 137
             .:|:|     ||...|
  Rat   132 TRHCAGHDLSEWLKGCD 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysSNP_476829.1 LYZ_C_invert 20..139 CDD:381618 44/128 (34%)
Spaca5NP_001101528.1 LYZ_C 22..147 CDD:340383 43/125 (34%)

Return to query results.
Submit another query.