DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysS and Lyzl6

DIOPT Version :9

Sequence 1:NP_476829.1 Gene:LysS / 38130 FlyBaseID:FBgn0004430 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001129305.2 Gene:Lyzl6 / 287751 RGDID:1306968 Length:149 Species:Rattus norvegicus


Alignment Length:127 Identity:48/127 - (37%)
Similarity:64/127 - (50%) Gaps:15/127 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GRTLDRCSLAREM--ADL-GVPRDQLDKWTCIAQHESDYRTWVVGPANSDGSNDYGIFQINDLYW 80
            |..::||:|||.:  .|| |.....|..|.|:|..||.:....| ..|:||:.||||||||..||
  Rat    20 GSIINRCTLARILYQEDLDGFEGYSLPHWLCLAFVESKFNISKV-TENADGTFDYGIFQINSRYW 83

  Fly    81 CQADGRFSYNECGLSCNALLTDDITNSVRCAQKVLSQQG----WSAWAVWHYCSG-----WL 133
            |......|.|.|.|.|..||..::..|:.||:.::|..|    |..|.:  :|.|     ||
  Rat    84 CNDYQSHSENFCRLDCEELLNPNLIPSIHCAKMIVSGSGGMKNWVDWRL--HCLGRPLSYWL 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysSNP_476829.1 LYZ1 20..140 CDD:197612 47/126 (37%)
Lyzl6NP_001129305.2 LYZ1 22..143 CDD:238066 45/123 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347517
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8912
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.