DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysS and Spaca3

DIOPT Version :9

Sequence 1:NP_476829.1 Gene:LysS / 38130 FlyBaseID:FBgn0004430 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001099290.1 Gene:Spaca3 / 287557 RGDID:1306684 Length:163 Species:Rattus norvegicus


Alignment Length:141 Identity:45/141 - (31%)
Similarity:68/141 - (48%) Gaps:14/141 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLAIAAPALAGRTLDRCSLAREMADLGVPRDQ---LDKWTCIAQHESDYRTWVVGPANSDGSNDY 70
            ||:....:...:...||.||:.:.|.|:...:   |..|.|:|.:.|.:.|..| ...:|||.:.
  Rat    25 LLSCLLASSKAKVFSRCELAKVLHDFGLEGYRGYNLADWICLAYYTSGFNTDAV-DHEADGSTNN 88

  Fly    71 GIFQINDLYWCQADGRFSYNECGLSCNALLTDDITNSVRCAQKVLSQ-QGWSAWAVW-HYCSG-- 131
            |||||:...||:.......|.|.:.|..||::|:.:||.|..|:..: ||...|..| |:|.|  
  Rat    89 GIFQISSRKWCKNLAPNGPNLCRIYCTDLLSNDLKDSVACVMKIAQEPQGLGYWESWKHHCQGRD 153

  Fly   132 ---WLPSIDEC 139
               |   :|.|
  Rat   154 LSDW---VDGC 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysSNP_476829.1 LYZ1 20..140 CDD:197612 43/130 (33%)
Spaca3NP_001099290.1 LYZ_C 36..161 CDD:340383 42/128 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347569
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8912
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.