DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysS and CG30062

DIOPT Version :9

Sequence 1:NP_476829.1 Gene:LysS / 38130 FlyBaseID:FBgn0004430 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_725299.2 Gene:CG30062 / 246428 FlyBaseID:FBgn0050062 Length:171 Species:Drosophila melanogaster


Alignment Length:141 Identity:65/141 - (46%)
Similarity:92/141 - (65%) Gaps:12/141 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FFALVLLAIAAPALAGRTLDRCSLAREMADLGVPRDQLDKWTCIAQHESDYRTWVVGPANSDGSN 68
            |..:.||||        .|..|.||.::..|.||:.:|..|.|||:.||.:.|.|||.||:|||.
  Fly    19 FHGIPLLAI--------RLQPCELAGQLYILDVPKSELPLWLCIAEFESRFNTHVVGQANADGSR 75

  Fly    69 DYGIFQINDLYWCQADGR---FSYNECGLSCNALLTDDITNSVRCAQKVLSQQGWSAWAVW-HYC 129
            |||:|||:|.|||....|   :::|:|.::|..||:||||.:|:||:.:..||||:||:|: .:|
  Fly    76 DYGLFQISDRYWCAPPNRTEYYAFNDCNVNCTHLLSDDITMAVQCARLIQKQQGWTAWSVYPEFC 140

  Fly   130 SGWLPSIDECF 140
            :|.|.:||.||
  Fly   141 NGTLDAIDVCF 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysSNP_476829.1 LYZ1 20..140 CDD:197612 58/123 (47%)
CG30062NP_725299.2 lysozyme_like 32..150 CDD:294153 57/117 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468989
Domainoid 1 1.000 111 1.000 Domainoid score I12139
eggNOG 1 0.900 - - E1_2BPI7
Homologene 1 1.000 - - H80675
Inparanoid 1 1.050 130 1.000 Inparanoid score I7030
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 1 1.000 - - FOG0004526
OrthoInspector 1 1.000 - - mtm8677
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
1110.900

Return to query results.
Submit another query.