DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysS and Lyz2

DIOPT Version :9

Sequence 1:NP_476829.1 Gene:LysS / 38130 FlyBaseID:FBgn0004430 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_059068.1 Gene:Lyz2 / 17105 MGIID:96897 Length:148 Species:Mus musculus


Alignment Length:136 Identity:57/136 - (41%)
Similarity:77/136 - (56%) Gaps:9/136 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFFALVLLAIAAPALAGRTLDRCSLAREMADLGVP---RDQLDKWTCIAQHESDYRTWVVGPA 62
            ||....|.||.::..|.| :..:||..||.:...|:.   ...|..|.|:|||||:|.|......
Mouse     1 MKTLLTLGLLLLSVTAQA-KVYERCEFARTLKRNGMAGYYGVSLADWVCLAQHESNYNTRATNYN 64

  Fly    63 NSDGSNDYGIFQINDLYWCQADGRF--SYNECGLSCNALLTDDITNSVRCAQKVL-SQQGWSAWA 124
            ..|.|.||||||||..|||. ||:.  :.|.||::|:|||.||||.:::||::|: ..||..||.
Mouse    65 RGDQSTDYGIFQINSRYWCN-DGKTPRAVNACGINCSALLQDDITAAIQCAKRVVRDPQGIRAWV 128

  Fly   125 VWH-YC 129
            .|. :|
Mouse   129 AWRAHC 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysSNP_476829.1 LYZ1 20..140 CDD:197612 50/117 (43%)
Lyz2NP_059068.1 LYZ1 19..147 CDD:197612 50/117 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844172
Domainoid 1 1.000 108 1.000 Domainoid score I6421
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4836
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8677
orthoMCL 1 0.900 - - OOG6_107030
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.810

Return to query results.
Submit another query.