DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysS and LYZL4

DIOPT Version :9

Sequence 1:NP_476829.1 Gene:LysS / 38130 FlyBaseID:FBgn0004430 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001291315.1 Gene:LYZL4 / 131375 HGNCID:28387 Length:146 Species:Homo sapiens


Alignment Length:150 Identity:45/150 - (30%)
Similarity:73/150 - (48%) Gaps:17/150 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFFALVLLAIAAPALAGRTLDRCSLAREMADLGVPRDQ---LDKWTCIAQHESDYRTWVVGPA 62
            |||...|.||...........|.||::|:::.|.|:...:   |:.|.|:|..||.:....:...
Human     1 MKASVVLSLLGYLVVPSGAYILGRCTVAKKLHDGGLDYFEGYSLENWVCLAYFESKFNPMAIYEN 65

  Fly    63 NSDGSNDYGIFQINDLYWCQADGRFSYNECGLSCNALLTDDITNSVRCAQKVL-SQQGWSAWAVW 126
            ..:|...:|:||:....||...||   |.|.:||:|||..::..:::||:.:: .::|..||..|
Human    66 TREGYTGFGLFQMRGSDWCGDHGR---NRCHMSCSALLNPNLEKTIKCAKTIVKGKEGMGAWPTW 127

  Fly   127 -HYC------SGWLPSIDEC 139
             .||      :.||   |.|
Human   128 SRYCQYSDTLARWL---DGC 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysSNP_476829.1 LYZ1 20..140 CDD:197612 38/130 (29%)
LYZL4NP_001291315.1 LYZ_C 21..144 CDD:340383 38/128 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153908
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8437
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.