DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysS and lyz

DIOPT Version :9

Sequence 1:NP_476829.1 Gene:LysS / 38130 FlyBaseID:FBgn0004430 Length:140 Species:Drosophila melanogaster
Sequence 2:XP_002938553.2 Gene:lyz / 100492798 XenbaseID:XB-GENE-488433 Length:153 Species:Xenopus tropicalis


Alignment Length:133 Identity:52/133 - (39%)
Similarity:70/133 - (52%) Gaps:16/133 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GRTLDRCSLAREMADLGVPRDQ---LDKWTCIAQHESDYRTWVVGPANSDGSNDYGIFQINDLYW 80
            |:..:||.||..|..:|:...:   |..|.|.|..||.:.|........|.|.||||.|||..:|
 Frog    19 GKLFERCELAGIMKKMGLDGYRGYSLPNWVCTAFFESSFYTDRTNFNRGDNSTDYGILQINSRWW 83

  Fly    81 CQADGRF--SYNECGLSCNALLTDDITNSVRCAQKVL-SQQGWSAWAVW-HYCSG-----WLPSI 136
            |. |.:.  |:|.|.::|.|||:||||.||.||::|: ..||..||..| ::|.|     |   |
 Frog    84 CN-DNKTPGSHNACNINCRALLSDDITQSVICAKRVVRDPQGMEAWVGWRNHCKGRDLSQW---I 144

  Fly   137 DEC 139
            .:|
 Frog   145 KDC 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysSNP_476829.1 LYZ1 20..140 CDD:197612 51/132 (39%)
lyzXP_002938553.2 LYZ_C 20..147 CDD:340383 50/130 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I6953
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I4849
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9324
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.080

Return to query results.
Submit another query.