DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysP and SPACA5B

DIOPT Version :9

Sequence 1:NP_476828.1 Gene:LysP / 38129 FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_001073369.1 Gene:SPACA5B / 729201 HGNCID:19142 Length:159 Species:Homo sapiens


Alignment Length:141 Identity:50/141 - (35%)
Similarity:81/141 - (57%) Gaps:13/141 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAF--LVICALTLTAVATQARTMDRCSLAREMSKLGVPRDQ---LAKWTCIAQHESSFRTGVVG 60
            |||:  :|:...||..|...|:..:||.||..:.:.|:...:   :..|.|:|.:||.|.|..| 
Human     1 MKAWGTVVVTLATLMVVTVDAKIYERCELAARLERAGLNGYKGYGVGDWLCMAHYESGFDTAFV- 64

  Fly    61 PANSNGSNDYGIFQINNKYWCKPADGRF--SYNECGLSCNALLTDDITNSVKCARKI-QRQQGWT 122
            ..|.:||::|||||:|:.:||   |...  :.|.|.:.|:.||...|.:.::||::| ..|.|.:
Human    65 DHNPDGSSEYGIFQLNSAWWC---DNGITPTKNLCHMDCHDLLNRHILDDIRCAKQIVSSQNGLS 126

  Fly   123 AWSTWK-YCSG 132
            ||::|: :|||
Human   127 AWTSWRLHCSG 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysPNP_476828.1 LYZ1 20..141 CDD:197612 42/120 (35%)
SPACA5BNP_001073369.1 LYZ_C 22..147 CDD:340383 42/120 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153979
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8437
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4912
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.890

Return to query results.
Submit another query.