DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysP and Lyc2

DIOPT Version :9

Sequence 1:NP_476828.1 Gene:LysP / 38129 FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_001381322.1 Gene:Lyc2 / 688047 RGDID:1593616 Length:148 Species:Rattus norvegicus


Alignment Length:135 Identity:57/135 - (42%)
Similarity:81/135 - (60%) Gaps:6/135 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFLVICALTLTAVATQARTMDRCSLA---REMSKLGVPRDQLAKWTCIAQHESSFRTGVVGPA 62
            |||.||:..|.|:| :.||:....|.||   |..:..|.....|..|.|:|||||:|.|..:...
  Rat     1 MKALLVLGFLLLSA-SVQAKVFKHCELARILRSSALAGYRGVSLENWMCMAQHESNFDTEAINYN 64

  Fly    63 NSNGSNDYGIFQINNKYWCKPADGRFSYNECGLSCNALLTDDITNSVKCARKIQRQ-QGWTAWST 126
            :::.|.||||||||::|||.......:.|.||:.|:|||.||||.:::||:::.|. ||..||..
  Rat    65 STDQSTDYGIFQINSRYWCNDGKTPRAVNACGIPCSALLQDDITQAIQCAKRVVRDPQGIRAWVA 129

  Fly   127 W-KYC 130
            | ::|
  Rat   130 WQRHC 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysPNP_476828.1 LYZ1 20..141 CDD:197612 47/116 (41%)
Lyc2NP_001381322.1 LYZ1 19..147 CDD:197612 47/116 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347542
Domainoid 1 1.000 106 1.000 Domainoid score I6429
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I4799
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8912
orthoMCL 1 0.900 - - OOG6_107030
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.