DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysP and MGC89221

DIOPT Version :9

Sequence 1:NP_476828.1 Gene:LysP / 38129 FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_001004951.1 Gene:MGC89221 / 448362 XenbaseID:XB-GENE-5851163 Length:140 Species:Xenopus tropicalis


Alignment Length:139 Identity:49/139 - (35%)
Similarity:74/139 - (53%) Gaps:16/139 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFLVICALTLTAVATQARTMDRCSLAREMSK---LGVPRDQLAKWTCIAQHESSFRTGVVGPA 62
            ||.|:::  :...|.|..:..:||||:.|.:..   :|:....|..:.|:|...|.:.|.:    
 Frog     1 MKIFVLL--MITAAFAAHSWALDRCSVVRAIRNGGVIGIKGYTLGDYVCLAYQASRYDTSL---- 59

  Fly    63 NSNGSNDYGIFQINNKYWCKPADGRF--SYNECGLSCNALLTDDITNSVKCARKIQRQ-QGWTAW 124
             :....:|||||||:.:||.  |||.  ..|.||:||.:||..:|.:.|:|.|:|.|. .|..||
 Frog    60 -NRSPTEYGIFQINSYWWCD--DGRTVGRKNLCGMSCRSLLNSNIGDDVRCLRRIVRDPNGLDAW 121

  Fly   125 STW-KYCSG 132
            |.| :||.|
 Frog   122 SVWTRYCKG 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysPNP_476828.1 LYZ1 20..141 CDD:197612 44/120 (37%)
MGC89221NP_001004951.1 LYZ1 20..136 CDD:238066 44/118 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9324
Panther 1 1.100 - - O PTHR11407
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4912
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.140

Return to query results.
Submit another query.