DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysP and LYZ

DIOPT Version :9

Sequence 1:NP_476828.1 Gene:LysP / 38129 FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_000230.1 Gene:LYZ / 4069 HGNCID:6740 Length:148 Species:Homo sapiens


Alignment Length:132 Identity:54/132 - (40%)
Similarity:78/132 - (59%) Gaps:5/132 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFLVICALTLTAVATQARTMDRCSLAREMSKLGVPRDQ---LAKWTCIAQHESSFRTGVVGPA 62
            ||| |::..|.|.:|..|.:..:||.|||.:.:||:...:   ||.|.|:|:.||.:.|......
Human     1 MKA-LIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYN 64

  Fly    63 NSNGSNDYGIFQINNKYWCKPADGRFSYNECGLSCNALLTDDITNSVKCARKIQRQ-QGWTAWST 126
            ..:.|.||||||||::|||.......:.|.|.|||:|||.|:|.::|.||:::.|. ||..||..
Human    65 AGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVA 129

  Fly   127 WK 128
            |:
Human   130 WR 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysPNP_476828.1 LYZ1 20..141 CDD:197612 46/113 (41%)
LYZNP_000230.1 LYZ1 19..147 CDD:197612 46/113 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153934
Domainoid 1 1.000 109 1.000 Domainoid score I6334
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4849
Isobase 1 0.950 - 0 Normalized mean entropy S6481
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8437
orthoMCL 1 0.900 - - OOG6_107030
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4912
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.