DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysP and SPACA5

DIOPT Version :9

Sequence 1:NP_476828.1 Gene:LysP / 38129 FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_001381227.1 Gene:SPACA5 / 389852 HGNCID:31353 Length:159 Species:Homo sapiens


Alignment Length:143 Identity:50/143 - (34%)
Similarity:81/143 - (56%) Gaps:17/143 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAF--LVICALTLTAVATQARTMDRCSLAREMSKLGVPRDQ---LAKWTCIAQHESSFRTGVVG 60
            |||:  :|:...||..|...|:..:||.||..:.:.|:...:   :..|.|:|.:||.|.|..| 
Human     1 MKAWGTVVVTLATLMVVTVDAKIYERCELAARLERAGLNGYKGYGVGDWLCMAHYESGFDTAFV- 64

  Fly    61 PANSNGSNDYGIFQINNKYWC----KPADGRFSYNECGLSCNALLTDDITNSVKCARKI-QRQQG 120
            ..|.:||::|||||:|:.:||    .|     :.|.|.:.|:.||...|.:.::||::| ..|.|
Human    65 DHNPDGSSEYGIFQLNSAWWCDNGITP-----TKNLCHMDCHDLLNRHILDDIRCAKQIVSSQNG 124

  Fly   121 WTAWSTWK-YCSG 132
            .:||::|: :|||
Human   125 LSAWTSWRLHCSG 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysPNP_476828.1 LYZ1 20..141 CDD:197612 42/122 (34%)
SPACA5NP_001381227.1 LYZ_C 22..147 CDD:340383 42/122 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153980
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8437
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4912
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.