DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysP and CG8492

DIOPT Version :10

Sequence 1:NP_476828.1 Gene:LysP / 38129 FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_648151.2 Gene:CG8492 / 38866 FlyBaseID:FBgn0035813 Length:1360 Species:Drosophila melanogaster


Alignment Length:133 Identity:54/133 - (40%)
Similarity:75/133 - (56%) Gaps:15/133 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RTMDRCSLAREM---SKLGVPRDQLAKWTCIAQHESSFRTGVVGPANSNGSNDYGIFQINNKYWC 81
            :..:||.||:|:   .|.  |...||.|.|||:|||||.|..||..|::||.|:|:|||::.|||
  Fly   439 KVYNRCELAQELYFSHKF--PMQDLATWVCIAEHESSFNTTAVGRLNADGSADHGLFQISDLYWC 501

  Fly    82 KPADGRFSYNECGLSCNALLTDDITNSVKCARKIQRQ------QGWTAWSTWK-YC-SGSLPSIN 138
            ...||  ....|.:.||.||..|||:.|||.|.|..:      .|:|||:.:. :| ..:...:.
  Fly   502 THNDG--GGKGCHIDCNRLLDSDITDDVKCVRTIHEEHTRISGDGFTAWTVYNGHCRQKTRADVA 564

  Fly   139 SCF 141
            :||
  Fly   565 NCF 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysPNP_476828.1 LYZ_C_invert 20..140 CDD:381618 52/130 (40%)
CG8492NP_648151.2 LYZ_C_invert 18..144 CDD:381618
LYZ_C_invert 185..301 CDD:381618
LYZ_C_invert 439..566 CDD:381618 52/130 (40%)
LYZ_C_invert 596..723 CDD:381618
Herpes_BLLF1 <823..1261 CDD:282904
PHA03255 937..>1067 CDD:165513
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.