DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysP and LysX

DIOPT Version :9

Sequence 1:NP_476828.1 Gene:LysP / 38129 FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_523881.1 Gene:LysX / 38122 FlyBaseID:FBgn0004431 Length:142 Species:Drosophila melanogaster


Alignment Length:141 Identity:96/141 - (68%)
Similarity:115/141 - (81%) Gaps:0/141 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFLVICALTLTAVATQARTMDRCSLAREMSKLGVPRDQLAKWTCIAQHESSFRTGVVGPANSN 65
            |:|.|.||.|.|...|...||||||||||||:.:||.||||:||.|||:||||:|||||||.|::
  Fly     1 MRALLGICVLALVTPAVLGRTMDRCSLAREMANMGVSRDQLSKWACIAEHESSYRTGVVGPPNTD 65

  Fly    66 GSNDYGIFQINNKYWCKPADGRFSYNECGLSCNALLTDDITNSVKCARKIQRQQGWTAWSTWKYC 130
            |||||||||||:.|||:|:.|:||:|.|.:||||||||||.:||:||.|:..||||:|||||.||
  Fly    66 GSNDYGIFQINDMYWCQPSSGKFSHNGCDVSCNALLTDDIKSSVRCALKVLGQQGWSAWSTWHYC 130

  Fly   131 SGSLPSINSCF 141
            ||.||.|:.||
  Fly   131 SGYLPPIDDCF 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysPNP_476828.1 LYZ1 20..141 CDD:197612 86/120 (72%)
LysXNP_523881.1 lysozyme_like 20..140 CDD:294153 86/119 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468980
Domainoid 1 1.000 111 1.000 Domainoid score I12139
eggNOG 1 0.900 - - E1_2BPI7
Homologene 1 1.000 - - H80675
Inparanoid 1 1.050 130 1.000 Inparanoid score I7030
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 1 1.000 - - FOG0004526
OrthoInspector 1 1.000 - - mtm8677
orthoMCL 1 0.900 - - OOG6_107030
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
1312.810

Return to query results.
Submit another query.