DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysP and CG11159

DIOPT Version :10

Sequence 1:NP_476828.1 Gene:LysP / 38129 FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_611505.1 Gene:CG11159 / 37341 FlyBaseID:FBgn0034539 Length:146 Species:Drosophila melanogaster


Alignment Length:145 Identity:50/145 - (34%)
Similarity:77/145 - (53%) Gaps:18/145 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FLVICALTLTAVATQARTMDRCSLAREMSKLGVPRDQLAKWTCIAQHESSFRTGVVGPANS---- 64
            |||:..|.|:...|:::.:.||.||:|:.:...||..|:.|.|:.:.||       |.:.|    
  Fly    12 FLVLNLLLLSQWETESKLLTRCQLAKELLRHDFPRSYLSNWVCLVEAES-------GRSTSKSMQ 69

  Fly    65 --NGSNDYGIFQINNKYWCKPADGRFSYNECGLSCNALLTDDITNSVKCARKIQRQQGWTAWSTW 127
              |.|..||:||||:|.||:  .||.. ..|.:.|...|.|:|::..:||.:|..:.|:.||..|
  Fly    70 LPNQSVSYGLFQINSKNWCR--KGRRG-GICNIKCEEFLNDEISDDSRCAMQIFNRHGFQAWPGW 131

  Fly   128 -KYCSG-SLPSINSC 140
             ..|.| :||.::.|
  Fly   132 MSKCRGRTLPDVSRC 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysPNP_476828.1 LYZ_C_invert 20..140 CDD:381618 43/127 (34%)
CG11159NP_611505.1 LYZ_C_invert 28..146 CDD:381618 43/127 (34%)

Return to query results.
Submit another query.