DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysP and CG7798

DIOPT Version :10

Sequence 1:NP_476828.1 Gene:LysP / 38129 FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_611098.1 Gene:CG7798 / 36798 FlyBaseID:FBgn0034092 Length:148 Species:Drosophila melanogaster


Alignment Length:138 Identity:64/138 - (46%)
Similarity:92/138 - (66%) Gaps:5/138 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVICALTLTAVATQARTMDRCSLAREMSKLGVPRDQLAKWTCIAQHESSFRTGVVGPANSNGSND 69
            ||:..|:|..    .|.:.||||||::.:.|:..::|..|.|:.:.||||.|..:.|:|.:||.|
  Fly     7 LVLLTLSLAT----GRQVGRCSLARQLYRYGMAYNELPDWLCLVEGESSFNTKAINPSNVDGSVD 67

  Fly    70 YGIFQINNKYWCKPADGRFSYNECGLSCNALLTDDITNSVKCARKIQRQQGWTAWSTW-KYCSGS 133
            :|:||||::|||||||||.|.:.|.|.|..||:|||..|:.||:.|::|||::||..| ..|.|.
  Fly    68 WGLFQINDRYWCKPADGRPSNDLCRLPCRLLLSDDIRYSIACAKYIRKQQGFSAWVAWNNRCQGV 132

  Fly   134 LPSINSCF 141
            .|::|.||
  Fly   133 KPNVNHCF 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysPNP_476828.1 LYZ_C_invert 20..140 CDD:381618 58/120 (48%)
CG7798NP_611098.1 LYZ_C_invert 18..139 CDD:381618 58/120 (48%)

Return to query results.
Submit another query.