DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysP and CG16756

DIOPT Version :9

Sequence 1:NP_476828.1 Gene:LysP / 38129 FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_572222.2 Gene:CG16756 / 31460 FlyBaseID:FBgn0029765 Length:152 Species:Drosophila melanogaster


Alignment Length:132 Identity:46/132 - (34%)
Similarity:74/132 - (56%) Gaps:9/132 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LTLTAVATQARTMDRCSLARE-MSKLGVPRDQLAKWTCIAQHESSFRTGVVGPANSNGSNDYGIF 73
            |.:......|:...||.|||: :.:.|..|..|:.|.|:.:|||...||.: ..|:|||.:||:|
  Fly    20 LAIECGVVSAKRFLRCELARKLLDQHGFERSLLSNWICLLEHESDLDTGRI-TTNANGSRNYGLF 83

  Fly    74 QINNKYWCKPADGRFSYNECGLSCNALLTDDITNSVKCARKIQRQQGWTAWSTW-KYC--SGSLP 135
            |||.:: |:  :||.. ..|...|...|.:::..||.||::||...|:..|:.| :||  :.:||
  Fly    84 QINGRF-CQ--EGRRG-GICNAKCEDFLDENLRESVTCAKRIQTSDGFRHWAGWQRYCRNAQNLP 144

  Fly   136 SI 137
            ::
  Fly   145 NL 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysPNP_476828.1 LYZ1 20..141 CDD:197612 44/122 (36%)
CG16756NP_572222.2 LYZ1 30..145 CDD:238066 43/119 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458904
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
76.860

Return to query results.
Submit another query.