DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysP and Lyzl6

DIOPT Version :9

Sequence 1:NP_476828.1 Gene:LysP / 38129 FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_001129305.2 Gene:Lyzl6 / 287751 RGDID:1306968 Length:149 Species:Rattus norvegicus


Alignment Length:137 Identity:48/137 - (35%)
Similarity:67/137 - (48%) Gaps:7/137 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFLVICALTLTAVATQARTMDRCSLAREMSKL---GVPRDQLAKWTCIAQHESSFRTGVVGPA 62
            |...|.||.::...|......::||:|||.:.:.   |.....|..|.|:|..||.|....| ..
  Rat     2 MMRVLFICVVSCLLVVNDGSIINRCTLARILYQEDLDGFEGYSLPHWLCLAFVESKFNISKV-TE 65

  Fly    63 NSNGSNDYGIFQINNKYWCKPADGRFSYNECGLSCNALLTDDITNSVKCARKI-QRQQGWTAWST 126
            |::|:.||||||||::|||...... |.|.|.|.|..||..::..|:.||:.| ....|...|..
  Rat    66 NADGTFDYGIFQINSRYWCNDYQSH-SENFCRLDCEELLNPNLIPSIHCAKMIVSGSGGMKNWVD 129

  Fly   127 WK-YCSG 132
            |: :|.|
  Rat   130 WRLHCLG 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysPNP_476828.1 LYZ1 20..141 CDD:197612 43/118 (36%)
Lyzl6NP_001129305.2 LYZ1 22..143 CDD:238066 43/117 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347519
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8912
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.