DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysP and Spaca3

DIOPT Version :9

Sequence 1:NP_476828.1 Gene:LysP / 38129 FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_001099290.1 Gene:Spaca3 / 287557 RGDID:1306684 Length:163 Species:Rattus norvegicus


Alignment Length:137 Identity:49/137 - (35%)
Similarity:75/137 - (54%) Gaps:15/137 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AFLVICALTLTAVATQARTMDRCSLAREMSKLGVPRDQ---LAKWTCIAQHESSFRTGVVGPANS 64
            |:|:.|.|    .:::|:...||.||:.:...|:...:   ||.|.|:|.:.|.|.|..| ...:
  Rat    23 AYLLSCLL----ASSKAKVFSRCELAKVLHDFGLEGYRGYNLADWICLAYYTSGFNTDAV-DHEA 82

  Fly    65 NGSNDYGIFQINNKYWCK--PADGRFSYNECGLSCNALLTDDITNSVKCARKI-QRQQGWTAWST 126
            :||.:.|||||:::.|||  ..:|.   |.|.:.|..||::|:.:||.|..|| |..||...|.:
  Rat    83 DGSTNNGIFQISSRKWCKNLAPNGP---NLCRIYCTDLLSNDLKDSVACVMKIAQEPQGLGYWES 144

  Fly   127 WK-YCSG 132
            || :|.|
  Rat   145 WKHHCQG 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysPNP_476828.1 LYZ1 20..141 CDD:197612 44/120 (37%)
Spaca3NP_001099290.1 LYZ_C 36..161 CDD:340383 44/120 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347571
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8912
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.