DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysP and SPACA3

DIOPT Version :9

Sequence 1:NP_476828.1 Gene:LysP / 38129 FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_776246.1 Gene:SPACA3 / 124912 HGNCID:16260 Length:215 Species:Homo sapiens


Alignment Length:132 Identity:43/132 - (32%)
Similarity:68/132 - (51%) Gaps:7/132 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VICALTLTAVATQARTMDRCSLAREMSKLGVPRDQ---LAKWTCIAQHESSFRTGVVGPANSNGS 67
            ::|.|:....:::|:...||.|||.:...|:...:   ||.|.|:|...|.|....: ...::||
Human    74 LVCLLSCLLPSSEAKLYGRCELARVLHDFGLDGYRGYSLADWVCLAYFTSGFNAAAL-DYEADGS 137

  Fly    68 NDYGIFQINNKYWCKPADGRFSYNECGLSCNALLTDDITNSVKCARKI-QRQQGWTAWSTWK-YC 130
            .:.||||||::.||........ |.|.:.|:.||..::.::|.||.|| |..||...|..|: :|
Human   138 TNNGIFQINSRRWCSNLTPNVP-NVCRMYCSDLLNPNLKDTVICAMKITQEPQGLGYWEAWRHHC 201

  Fly   131 SG 132
            .|
Human   202 QG 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysPNP_476828.1 LYZ1 20..141 CDD:197612 40/118 (34%)
SPACA3NP_776246.1 LYZ_C 88..213 CDD:340383 40/118 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153966
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8437
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4912
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.