DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysP and LOC100493330

DIOPT Version :9

Sequence 1:NP_476828.1 Gene:LysP / 38129 FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster
Sequence 2:XP_002935753.1 Gene:LOC100493330 / 100493330 -ID:- Length:140 Species:Xenopus tropicalis


Alignment Length:137 Identity:45/137 - (32%)
Similarity:66/137 - (48%) Gaps:12/137 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFLVICALTLTAVATQARTMDRCSLAREMSK---LGVPRDQLAKWTCIAQHESSFRTGVVGPA 62
            ||..|:|  :...|:|..:..:||||:.|.:.:   .|:....|..:.|:|.|.|.:.|.:    
 Frog     1 MKICLMI--VVAAALAGNSWALDRCSVVRAIRRGGLAGIKGYSLGDFVCLAYHASRYDTSL---- 59

  Fly    63 NSNGSNDYGIFQINNKYWCKPADGRFSYNECGLSCNALLTDDITNSVKCARKI-QRQQGWTAWST 126
             .....:|||||||:.:||.........|.|.:.|..||..:|.:.|||.::| ....|..||..
 Frog    60 -HRSPTEYGIFQINSYWWCDDGKTPGRKNVCRIPCRNLLNTNIADDVKCVKRIVSDPNGLAAWEP 123

  Fly   127 W-KYCSG 132
            | |||.|
 Frog   124 WKKYCRG 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysPNP_476828.1 LYZ1 20..141 CDD:197612 39/118 (33%)
LOC100493330XP_002935753.1 LYZ_C 20..140 CDD:340383 39/116 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I4849
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9324
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.