DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysP and lyz

DIOPT Version :9

Sequence 1:NP_476828.1 Gene:LysP / 38129 FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster
Sequence 2:XP_002938553.2 Gene:lyz / 100492798 XenbaseID:XB-GENE-488433 Length:153 Species:Xenopus tropicalis


Alignment Length:121 Identity:50/121 - (41%)
Similarity:68/121 - (56%) Gaps:5/121 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TQARTMDRCSLAREMSKLGVPRDQ---LAKWTCIAQHESSFRTGVVGPANSNGSNDYGIFQINNK 78
            |..:..:||.||..|.|:|:...:   |..|.|.|..||||.|........:.|.||||.|||::
 Frog    17 TDGKLFERCELAGIMKKMGLDGYRGYSLPNWVCTAFFESSFYTDRTNFNRGDNSTDYGILQINSR 81

  Fly    79 YWCKPADGRFSYNECGLSCNALLTDDITNSVKCARKIQRQ-QGWTAWSTWK-YCSG 132
            :||.......|:|.|.::|.|||:||||.||.||:::.|. ||..||..|: :|.|
 Frog    82 WWCNDNKTPGSHNACNINCRALLSDDITQSVICAKRVVRDPQGMEAWVGWRNHCKG 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysPNP_476828.1 LYZ1 20..141 CDD:197612 49/118 (42%)
lyzXP_002938553.2 LYZ_C 20..147 CDD:340383 49/118 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I6953
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I4849
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9324
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.080

Return to query results.
Submit another query.