DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysE and Spaca3

DIOPT Version :9

Sequence 1:NP_476827.2 Gene:LysE / 38128 FlyBaseID:FBgn0004428 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001346112.1 Gene:Spaca3 / 75622 MGIID:1922872 Length:163 Species:Mus musculus


Alignment Length:150 Identity:50/150 - (33%)
Similarity:75/150 - (50%) Gaps:20/150 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IVLVALA-----MAAPALGRTLDRCSLAREMSNLGVPRDQ---LARWACIAEHESSYRTGVVGPE 61
            |..:|||     :.|.:..:...||.||:||.:.|:...:   ||.|.|:|.:.|.:.|..|..|
Mouse    17 ITWLALAYLLSCLLASSKAKVFSRCELAKEMHDFGLDGYRGYNLADWVCLAYYTSGFNTNAVDHE 81

  Fly    62 NYNGSNDYGIFQINNYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVLSQQ-GWSAWST 125
             .:||.:.|||||::..||...:.. ..|.|.:.|..||.:|:..|:.||.|::.:. |...|..
Mouse    82 -ADGSTNNGIFQISSRRWCRTLASN-GPNLCRIYCTDLLNNDLKDSIVCAMKIVQEPLGLGYWEA 144

  Fly   126 W-HYCSG-----WLPSIDGC 139
            | |:|.|     |   :|||
Mouse   145 WRHHCQGRDLSDW---VDGC 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysENP_476827.2 Lys 19..139 CDD:278491 43/129 (33%)
Spaca3NP_001346112.1 LYZ1 36..159 CDD:238066 42/127 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844204
Domainoid 1 1.000 108 1.000 Domainoid score I6421
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4836
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8677
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4912
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.