DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysE and lyz

DIOPT Version :9

Sequence 1:NP_476827.2 Gene:LysE / 38128 FlyBaseID:FBgn0004428 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_631919.1 Gene:lyz / 677744 ZFINID:ZDB-GENE-020515-2 Length:151 Species:Danio rerio


Alignment Length:150 Identity:49/150 - (32%)
Similarity:77/150 - (51%) Gaps:19/150 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIVLVALAMAAPALGRTLDRCSLAREMSNLGVPRDQ---LARWACIAEHESSYRTGVVGPEN 62
            |:..:|.:.||..:....:||.||.:.:...|.|:...:   :..:.|.|..||.::|..|  .:
Zfish     1 MRLAVVFLCLAWMSSCESKTLGRCDVYKIFKNEGLDGFEGFSIGNYVCTAYWESRFKTHRV--RS 63

  Fly    63 YNGSNDYGIFQINNYYWC--APPSGRFSYNECGLSCNALLTDDITHSVRCAQKVLSQQGWSAWST 125
            .:...||||||||::.||  ..|.|:   |.|.::|:.||.||:..||.||:.::...|..:|.|
Zfish    64 ADTGKDYGIFQINSFKWCDDGTPGGK---NLCKVACSDLLNDDLKASVGCAKLIVKMDGLKSWET 125

  Fly   126 W-HYCSG-----WLPSIDGC 139
            | .||:|     |   :.||
Zfish   126 WDSYCNGRKMSRW---VKGC 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysENP_476827.2 Lys 19..139 CDD:278491 43/130 (33%)
lyzNP_631919.1 LYZ1 19..140 CDD:238066 43/128 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589124
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.