DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysE and LysS

DIOPT Version :9

Sequence 1:NP_476827.2 Gene:LysE / 38128 FlyBaseID:FBgn0004428 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_476829.1 Gene:LysS / 38130 FlyBaseID:FBgn0004430 Length:140 Species:Drosophila melanogaster


Alignment Length:141 Identity:115/141 - (81%)
Similarity:124/141 - (87%) Gaps:2/141 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIVLVALAMAAPAL-GRTLDRCSLAREMSNLGVPRDQLARWACIAEHESSYRTGVVGPENYN 64
            ||||..||.||:||||| |||||||||||||::||||||||.:|.|||:|||.|||.||||.|.:
  Fly     1 MKAFFALVLLAIAAPALAGRTLDRCSLAREMADLGVPRDQLDKWTCIAQHESDYRTWVVGPANSD 65

  Fly    65 GSNDYGIFQINNYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVLSQQGWSAWSTWHYC 129
            |||||||||||:.||| ...|||||||||||||||||||||:|||||||||||||||||:.||||
  Fly    66 GSNDYGIFQINDLYWC-QADGRFSYNECGLSCNALLTDDITNSVRCAQKVLSQQGWSAWAVWHYC 129

  Fly   130 SGWLPSIDGCF 140
            ||||||||.||
  Fly   130 SGWLPSIDECF 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysENP_476827.2 Lys 19..139 CDD:278491 99/119 (83%)
LysSNP_476829.1 LYZ1 20..140 CDD:197612 99/120 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468971
Domainoid 1 1.000 111 1.000 Domainoid score I12139
eggNOG 1 0.900 - - E1_2BPI7
Homologene 1 1.000 - - H80675
Inparanoid 1 1.050 130 1.000 Inparanoid score I7030
Isobase 1 0.950 - 0 Normalized mean entropy S6956
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 1 1.000 - - FOG0004526
OrthoInspector 1 1.000 - - mtm8677
orthoMCL 1 0.900 - - OOG6_107030
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
1413.760

Return to query results.
Submit another query.