DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysE and Lyzl1

DIOPT Version :9

Sequence 1:NP_476827.2 Gene:LysE / 38128 FlyBaseID:FBgn0004428 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001102352.1 Gene:Lyzl1 / 364745 RGDID:1559869 Length:148 Species:Rattus norvegicus


Alignment Length:136 Identity:49/136 - (36%)
Similarity:76/136 - (55%) Gaps:17/136 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKA---FIVLVALAMAAPALGRTLDRCSLAREMSNLGVPR---DQLARWACIAEHESSYRTGVVG 59
            |||   |.::::|.:.|.:  :...||.||:.....|:..   ..|..|.|:|.:||.|.|..  
  Rat     1 MKAVGVFALIMSLGIVAES--KVYTRCKLAKVFVKAGLDNYGGFTLGNWLCMAYYESHYNTSA-- 61

  Fly    60 PENY--NGSNDYGIFQINNYYWCAPPSG-RFSYNECGLSCNALLTDDITHSVRCAQKVLSQ-QGW 120
             |..  :||.||||||||::.||.  :| :...|.|.::|:||.|||:|.::.||:|::.: ||.
  Rat    62 -ETVLEDGSTDYGIFQINSFTWCR--NGKKHQKNHCHVACSALTTDDLTDAILCAKKIVKETQGM 123

  Fly   121 SAWSTW 126
            :.|..|
  Rat   124 NYWQGW 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysENP_476827.2 Lys 19..139 CDD:278491 43/115 (37%)
Lyzl1NP_001102352.1 LYZ1 20..143 CDD:238066 43/115 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347560
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8912
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.