DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysE and Lyzl6

DIOPT Version :9

Sequence 1:NP_476827.2 Gene:LysE / 38128 FlyBaseID:FBgn0004428 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001129305.2 Gene:Lyzl6 / 287751 RGDID:1306968 Length:149 Species:Rattus norvegicus


Alignment Length:149 Identity:51/149 - (34%)
Similarity:71/149 - (47%) Gaps:15/149 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIVLVALAMAAPALGRTLDRCSLAREM--SNL-GVPRDQLARWACIAEHESSYRTGVVGPEN 62
            |:...:.|...:.....|..::||:|||.:  .:| |.....|..|.|:|..||.:....| .||
  Rat     3 MRVLFICVVSCLLVVNDGSIINRCTLARILYQEDLDGFEGYSLPHWLCLAFVESKFNISKV-TEN 66

  Fly    63 YNGSNDYGIFQINNYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVLS-QQGWSAWSTW 126
            .:|:.||||||||:.|||...... |.|.|.|.|..||..::..|:.||:.::| ..|...|..|
  Rat    67 ADGTFDYGIFQINSRYWCNDYQSH-SENFCRLDCEELLNPNLIPSIHCAKMIVSGSGGMKNWVDW 130

  Fly   127 H-YCSG-----WLPSIDGC 139
            . :|.|     ||   .||
  Rat   131 RLHCLGRPLSYWL---TGC 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysENP_476827.2 Lys 19..139 CDD:278491 46/129 (36%)
Lyzl6NP_001129305.2 LYZ1 22..143 CDD:238066 44/122 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347516
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8912
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.