DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysE and Lyz2

DIOPT Version :9

Sequence 1:NP_476827.2 Gene:LysE / 38128 FlyBaseID:FBgn0004428 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_059068.1 Gene:Lyz2 / 17105 MGIID:96897 Length:148 Species:Mus musculus


Alignment Length:137 Identity:55/137 - (40%)
Similarity:77/137 - (56%) Gaps:11/137 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIVLVALAMAAPALGRTLDRCSLAREMSNLGVP---RDQLARWACIAEHESSYRTGVVGPEN 62
            ||..:.|..|.::..|..:..:||..||.:...|:.   ...||.|.|:|:|||:|.|...   |
Mouse     1 MKTLLTLGLLLLSVTAQAKVYERCEFARTLKRNGMAGYYGVSLADWVCLAQHESNYNTRAT---N 62

  Fly    63 YN---GSNDYGIFQINNYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVL-SQQGWSAW 123
            ||   .|.||||||||:.|||.......:.|.||::|:|||.||||.:::||::|: ..||..||
Mouse    63 YNRGDQSTDYGIFQINSRYWCNDGKTPRAVNACGINCSALLQDDITAAIQCAKRVVRDPQGIRAW 127

  Fly   124 STWH-YC 129
            ..|. :|
Mouse   128 VAWRAHC 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysENP_476827.2 Lys 19..139 CDD:278491 50/119 (42%)
Lyz2NP_059068.1 LYZ1 19..147 CDD:197612 50/119 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844169
Domainoid 1 1.000 108 1.000 Domainoid score I6421
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4836
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8677
orthoMCL 1 0.900 - - OOG6_107030
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4912
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.840

Return to query results.
Submit another query.