DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysE and SPACA3

DIOPT Version :9

Sequence 1:NP_476827.2 Gene:LysE / 38128 FlyBaseID:FBgn0004428 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_776246.1 Gene:SPACA3 / 124912 HGNCID:16260 Length:215 Species:Homo sapiens


Alignment Length:152 Identity:49/152 - (32%)
Similarity:73/152 - (48%) Gaps:20/152 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AFIVLVALAMAAPAL-----GRTLDRCSLAREMSNLGVPRDQ---LARWACIAEHESSYRTGVVG 59
            |.|:|:||......|     .:...||.|||.:.:.|:...:   ||.|.|:|...|.:....:.
Human    67 AGIMLLALVCLLSCLLPSSEAKLYGRCELARVLHDFGLDGYRGYSLADWVCLAYFTSGFNAAALD 131

  Fly    60 PENYNGSNDYGIFQINNYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVLSQ-QGWSAW 123
            .| .:||.:.||||||:..||:..:.... |.|.:.|:.||..::..:|.||.|:..: ||...|
Human   132 YE-ADGSTNNGIFQINSRRWCSNLTPNVP-NVCRMYCSDLLNPNLKDTVICAMKITQEPQGLGYW 194

  Fly   124 STW-HYCSG-----WLPSIDGC 139
            ..| |:|.|     |   :|||
Human   195 EAWRHHCQGKDLTEW---VDGC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysENP_476827.2 Lys 19..139 CDD:278491 41/129 (32%)
SPACA3NP_776246.1 LYZ_C 88..213 CDD:340383 41/129 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153963
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8437
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4912
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.