DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysE and LYZL2

DIOPT Version :9

Sequence 1:NP_476827.2 Gene:LysE / 38128 FlyBaseID:FBgn0004428 Length:140 Species:Drosophila melanogaster
Sequence 2:XP_011517608.1 Gene:LYZL2 / 119180 HGNCID:29613 Length:181 Species:Homo sapiens


Alignment Length:102 Identity:35/102 - (34%)
Similarity:51/102 - (50%) Gaps:8/102 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIVLVAL-AMAAPALGRTLDRCSLAREMSNLGVPR---DQLARWACIAEHESSYRTGVVGPE 61
            |||..:|..: .:...|..:...||.||:..|..|:..   ..|..|.|:|.:||.|.|......
Human    47 MKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVL 111

  Fly    62 NYNGSNDYGIFQINNYYWCAPPSGRF-SYNECGLSCN 97
            : :||.||||||||::.||.  .|:. ..|.|.::|:
Human   112 D-DGSIDYGIFQINSFAWCR--RGKLKENNHCHVACS 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysENP_476827.2 Lys 19..139 CDD:278491 30/83 (36%)
LYZL2XP_011517608.1 lysozyme_like 66..>145 CDD:294153 29/81 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153949
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6956
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8437
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.