DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysE and LOC100493330

DIOPT Version :9

Sequence 1:NP_476827.2 Gene:LysE / 38128 FlyBaseID:FBgn0004428 Length:140 Species:Drosophila melanogaster
Sequence 2:XP_002935753.1 Gene:LOC100493330 / 100493330 -ID:- Length:140 Species:Xenopus tropicalis


Alignment Length:142 Identity:47/142 - (33%)
Similarity:71/142 - (50%) Gaps:14/142 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IVLVALAMAAPALGRTLDRCSLAREMSN---LGVPRDQLARWACIAEHESSYRTGVVGPENYNGS 66
            :::||.|:|..:.  .|||||:.|.:..   .|:....|..:.|:|.|.|.|.|.:     :...
 Frog     6 MIVVAAALAGNSW--ALDRCSVVRAIRRGGLAGIKGYSLGDFVCLAYHASRYDTSL-----HRSP 63

  Fly    67 NDYGIFQINNYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVLSQ-QGWSAWSTW-HYC 129
            .:|||||||:|:||.........|.|.:.|..||..:|...|:|.::::|. .|.:||..| .||
 Frog    64 TEYGIFQINSYWWCDDGKTPGRKNVCRIPCRNLLNTNIADDVKCVKRIVSDPNGLAAWEPWKKYC 128

  Fly   130 SGWLPS--IDGC 139
            .|...|  :.||
 Frog   129 RGKNLSSYVRGC 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysENP_476827.2 Lys 19..139 CDD:278491 41/126 (33%)
LOC100493330XP_002935753.1 LYZ_C 20..140 CDD:340383 41/124 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I4849
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9324
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.