DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysD and Spaca3

DIOPT Version :9

Sequence 1:NP_476823.1 Gene:LysD / 38127 FlyBaseID:FBgn0004427 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001346112.1 Gene:Spaca3 / 75622 MGIID:1922872 Length:163 Species:Mus musculus


Alignment Length:141 Identity:47/141 - (33%)
Similarity:70/141 - (49%) Gaps:16/141 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LAC-AAPAFGRTMDRCSLAREMSNLGVPRDQ---LARWACIAEHESSYRTGVVGPENYNGSNDYG 70
            |:| .|.:..:...||.||:||.:.|:...:   ||.|.|:|.:.|.:.|..|..| .:||.:.|
Mouse    26 LSCLLASSKAKVFSRCELAKEMHDFGLDGYRGYNLADWVCLAYYTSGFNTNAVDHE-ADGSTNNG 89

  Fly    71 IFQINDYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVLSQQ-GWSAWSTW-HYCSG-- 131
            ||||:...||...:.. ..|.|.:.|..||.:|:..|:.||.|::.:. |...|..| |:|.|  
Mouse    90 IFQISSRRWCRTLASN-GPNLCRIYCTDLLNNDLKDSIVCAMKIVQEPLGLGYWEAWRHHCQGRD 153

  Fly   132 ---WLPSIDDC 139
               |   :|.|
Mouse   154 LSDW---VDGC 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysDNP_476823.1 LYZ_C_invert 19..139 CDD:381618 43/129 (33%)
Spaca3NP_001346112.1 LYZ1 36..159 CDD:238066 42/127 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844203
Domainoid 1 1.000 108 1.000 Domainoid score I6421
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4836
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8677
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.