DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysD and LYZ

DIOPT Version :9

Sequence 1:NP_476823.1 Gene:LysD / 38127 FlyBaseID:FBgn0004427 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_000230.1 Gene:LYZ / 4069 HGNCID:6740 Length:148 Species:Homo sapiens


Alignment Length:133 Identity:57/133 - (42%)
Similarity:73/133 - (54%) Gaps:10/133 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIVLVALACAAPAFGRTMDRCSLAREMSNLGVPRDQ---LARWACIAEHESSYRTGVVGPEN 62
            |||.|||..:..:....|:..:||.|||.:..||:...:   ||.|.|:|:.||.|.|...   |
Human     1 MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRAT---N 62

  Fly    63 YNG---SNDYGIFQINDYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVL-SQQGWSAW 123
            ||.   |.||||||||..|||.......:.|.|.|||:|||.|:|..:|.||::|: ..||..||
Human    63 YNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAW 127

  Fly   124 STW 126
            ..|
Human   128 VAW 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysDNP_476823.1 LYZ_C_invert 19..139 CDD:381618 50/115 (43%)
LYZNP_000230.1 LYZ1 19..147 CDD:197612 50/115 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153930
Domainoid 1 1.000 109 1.000 Domainoid score I6334
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4849
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8437
orthoMCL 1 0.900 - - OOG6_107030
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.810

Return to query results.
Submit another query.