DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysD and SPACA5

DIOPT Version :9

Sequence 1:NP_476823.1 Gene:LysD / 38127 FlyBaseID:FBgn0004427 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001381227.1 Gene:SPACA5 / 389852 HGNCID:31353 Length:159 Species:Homo sapiens


Alignment Length:154 Identity:51/154 - (33%)
Similarity:79/154 - (51%) Gaps:23/154 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAF---IVLVALACAAPAFGRTMDRCSLAREMSNLGVPRDQ---LARWACIAEHESSYRTGVVG 59
            |||:   :|.:|.........:..:||.||..:...|:...:   :..|.|:|.:||.:.|..| 
Human     1 MKAWGTVVVTLATLMVVTVDAKIYERCELAARLERAGLNGYKGYGVGDWLCMAHYESGFDTAFV- 64

  Fly    60 PENYNGSNDYGIFQINDYYWC----APPSGRFSYNECGLSCNALLTDDITHSVRCAQKVL-SQQG 119
            ..|.:||::|||||:|..:||    .|     :.|.|.:.|:.||...|...:|||:::: ||.|
Human    65 DHNPDGSSEYGIFQLNSAWWCDNGITP-----TKNLCHMDCHDLLNRHILDDIRCAKQIVSSQNG 124

  Fly   120 WSAWSTWH-YCSG-----WLPSID 137
            .|||::|. :|||     ||...|
Human   125 LSAWTSWRLHCSGHDLSEWLKGCD 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysDNP_476823.1 LYZ_C_invert 19..139 CDD:381618 46/133 (35%)
SPACA5NP_001381227.1 LYZ_C 22..147 CDD:340383 45/130 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153972
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8437
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.