DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysD and Lyzl4

DIOPT Version :9

Sequence 1:NP_476823.1 Gene:LysD / 38127 FlyBaseID:FBgn0004427 Length:140 Species:Drosophila melanogaster
Sequence 2:XP_006244185.3 Gene:Lyzl4 / 363168 RGDID:1308401 Length:265 Species:Rattus norvegicus


Alignment Length:151 Identity:45/151 - (29%)
Similarity:76/151 - (50%) Gaps:20/151 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIVLVALACAAPAFGRT-MDRCSLAREMSNLGVPRDQ---LARWACIAEHESSYRTGVVGPE 61
            |:.::||:.::......|.: :.||.:|:::.:.|:...:   |..|.|:|..||.:....|...
  Rat   121 MQLYLVLLLISYLLTPIGASILGRCVVAKKLYDGGLNYFEGYSLENWVCLAYFESKFNPSAVYEN 185

  Fly    62 NYNGSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVL-SQQGWSAWST 125
            :.:||..:|:|||.|..||  ..|:   |.|.:||.|||..::..::.||:|:: .:||..||..
  Rat   186 SRDGSTGFGLFQIRDNEWC--DHGK---NLCSVSCTALLNPNLKDTIECAKKIVKGKQGMGAWPV 245

  Fly   126 W-HYC------SGWLPSIDDC 139
            | ..|      ..||   |.|
  Rat   246 WSRNCQLSDILDRWL---DGC 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysDNP_476823.1 LYZ_C_invert 19..139 CDD:381618 40/131 (31%)
Lyzl4XP_006244185.3 LYZ_C 141..263 CDD:340383 40/129 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347503
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.