DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysD and RGD1306474

DIOPT Version :9

Sequence 1:NP_476823.1 Gene:LysD / 38127 FlyBaseID:FBgn0004427 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001102216.1 Gene:RGD1306474 / 362881 RGDID:1306474 Length:151 Species:Rattus norvegicus


Alignment Length:133 Identity:46/133 - (34%)
Similarity:69/133 - (51%) Gaps:7/133 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIVLVALA---CAAPAFGRTMDRCSLAREMSNLGV---PRDQLARWACIAEHESSYRTGVVG 59
            |||...|:.|.   .:....|:.::||.|||.:...|:   ....||.|.|:|:..|.|.|..:.
  Rat     1 MKALPTLLTLGLLLLSITVQGKVLNRCLLARTLQRFGLGGFKGISLANWICLAKSVSGYDTKAIK 65

  Fly    60 PENYNGSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVLSQ-QGWSAW 123
            ..:.:.|.:||||||:..|||.......|.|.|.:||.|||.::|..||.||::::.. :|.:.|
  Rat    66 YNHEDRSTNYGIFQISSRYWCNDSKTPGSKNFCRVSCKALLKNNIKASVTCAKRIVKDPRGITTW 130

  Fly   124 STW 126
            ..|
  Rat   131 EAW 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysDNP_476823.1 LYZ_C_invert 19..139 CDD:381618 40/112 (36%)
RGD1306474NP_001102216.1 LYZ1 22..149 CDD:197612 40/112 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347529
Domainoid 1 1.000 106 1.000 Domainoid score I6429
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I4799
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8912
orthoMCL 1 0.900 - - OOG6_107030
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.