DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysD and Spaca3

DIOPT Version :9

Sequence 1:NP_476823.1 Gene:LysD / 38127 FlyBaseID:FBgn0004427 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001099290.1 Gene:Spaca3 / 287557 RGDID:1306684 Length:163 Species:Rattus norvegicus


Alignment Length:143 Identity:48/143 - (33%)
Similarity:72/143 - (50%) Gaps:20/143 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LAC-AAPAFGRTMDRCSLAREMSNLGVPRDQ---LARWACIAEHESSYRTGVVGPENYNGSNDYG 70
            |:| .|.:..:...||.||:.:.:.|:...:   ||.|.|:|.:.|.:.|..|..| .:||.:.|
  Rat    26 LSCLLASSKAKVFSRCELAKVLHDFGLEGYRGYNLADWICLAYYTSGFNTDAVDHE-ADGSTNNG 89

  Fly    71 IFQINDYYWC--APPSGRFSYNECGLSCNALLTDDITHSVRCAQKVLSQ-QGWSAWSTW-HYCSG 131
            ||||:...||  ..|:|.   |.|.:.|..||::|:..||.|..|:..: ||...|.:| |:|.|
  Rat    90 IFQISSRKWCKNLAPNGP---NLCRIYCTDLLSNDLKDSVACVMKIAQEPQGLGYWESWKHHCQG 151

  Fly   132 -----WLPSIDDC 139
                 |   :|.|
  Rat   152 RDLSDW---VDGC 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysDNP_476823.1 LYZ_C_invert 19..139 CDD:381618 44/131 (34%)
Spaca3NP_001099290.1 LYZ_C 36..161 CDD:340383 44/131 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347567
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8912
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.