DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysD and Spaca5

DIOPT Version :9

Sequence 1:NP_476823.1 Gene:LysD / 38127 FlyBaseID:FBgn0004427 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001078862.1 Gene:Spaca5 / 278203 MGIID:2685564 Length:160 Species:Mus musculus


Alignment Length:143 Identity:45/143 - (31%)
Similarity:74/143 - (51%) Gaps:20/143 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IVLVALACAAPAFGRTMDRCSLAREMSNLGVPRDQ---LARWACIAEHESSYRTGVVGPENYNGS 66
            :|::|:...|....:..:||.||:::...|:...:   :..|.|:|.:||.:.|..| ..|.:||
Mouse     8 VVILAVLLIAKLDAKIYERCELAKKLEEAGLDGFKGYTVGDWLCVAHYESGFDTSFV-DHNPDGS 71

  Fly    67 NDYGIFQINDYYWC----APPSGRFSYNECGLSCNALLTDDITHSVRCAQKVL-SQQGWSAWSTW 126
            ::|||||:|..:||    .|     :.|.|.:.||.||...|...:.||::|. |.:...||.:|
Mouse    72 SEYGIFQLNSAWWCNNGITP-----TQNLCNIDCNDLLNRHILDDIICAKRVASSHKSMKAWDSW 131

  Fly   127 -HYCSG-----WL 133
             .:|:|     ||
Mouse   132 TQHCAGHDLSEWL 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysDNP_476823.1 LYZ_C_invert 19..139 CDD:381618 42/129 (33%)
Spaca5NP_001078862.1 LYZ1 22..145 CDD:238066 42/129 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844211
Domainoid 1 1.000 108 1.000 Domainoid score I6421
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4836
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8677
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.