DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysD and Lyz2

DIOPT Version :9

Sequence 1:NP_476823.1 Gene:LysD / 38127 FlyBaseID:FBgn0004427 Length:140 Species:Drosophila melanogaster
Sequence 2:XP_038934368.1 Gene:Lyz2 / 25211 RGDID:3026 Length:192 Species:Rattus norvegicus


Alignment Length:190 Identity:60/190 - (31%)
Similarity:81/190 - (42%) Gaps:60/190 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIVLVALACAAPAFGRTMDRCSLAREMSNLGVP---RDQLARWACIAEHESSYRTGVVGPEN 62
            |||.:||..|..:|....:|.:||..||.:...|:.   ...||.|.|:|:|||:|.|..   .|
  Rat     1 MKALLVLGFLLLSASVQAKTYERCEFARTLKRNGMSGYYGVSLADWVCLAQHESNYNTQA---RN 62

  Fly    63 YN---GSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNA-------------------------- 98
            ||   .|.||||||||..|||.......:.|.||:.|:|                          
  Rat    63 YNPGDQSTDYGIFQINSRYWCNDGKTPRAKNACGIPCSAVVTEKSSKHQQRRDILSLGTASIHLS 127

  Fly    99 ------------------LLTDDITHSVRCAQKVL-SQQGWSAWSTW-HYC-----SGWL 133
                              ||.||||.:::||::|: ..||..||..| .:|     ||::
  Rat   128 GSLWETLLRNVNPAVHTSLLQDDITQAIQCAKRVVRDPQGIRAWVAWQRHCKNRDLSGYI 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysDNP_476823.1 LYZ_C_invert 19..139 CDD:381618 53/172 (31%)
Lyz2XP_038934368.1 LYZ1 19..191 CDD:197612 53/172 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347531
Domainoid 1 1.000 106 1.000 Domainoid score I6429
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I4799
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8912
orthoMCL 1 0.900 - - OOG6_107030
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.