DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysD and Lyz1

DIOPT Version :9

Sequence 1:NP_476823.1 Gene:LysD / 38127 FlyBaseID:FBgn0004427 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_038618.1 Gene:Lyz1 / 17110 MGIID:96902 Length:148 Species:Mus musculus


Alignment Length:135 Identity:58/135 - (42%)
Similarity:77/135 - (57%) Gaps:14/135 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIVLVALACAAPAFGRTMDRCSLAREMSNLGVPRD-----QLARWACIAEHESSYRTGVVGP 60
            |||.:.|..|..:..|..:..:||.|||.:...|:  |     :||.|.|:|:|||:|.|...  
Mouse     1 MKALLTLGLLLLSVTAQAKVYNRCELARILKRNGM--DGYRGVKLADWVCLAQHESNYNTRAT-- 61

  Fly    61 ENYN---GSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVL-SQQGWS 121
             |||   .|.||||||||..|||.......|.|.||::|:|||.||||.:::||::|: ..||..
Mouse    62 -NYNRGDRSTDYGIFQINSRYWCNDGKTPRSKNACGINCSALLQDDITAAIQCAKRVVRDPQGIR 125

  Fly   122 AWSTW 126
            ||..|
Mouse   126 AWVAW 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysDNP_476823.1 LYZ_C_invert 19..139 CDD:381618 52/117 (44%)
Lyz1NP_038618.1 LYZ1 19..147 CDD:197612 52/117 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844167
Domainoid 1 1.000 108 1.000 Domainoid score I6421
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4836
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8677
orthoMCL 1 0.900 - - OOG6_107030
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.810

Return to query results.
Submit another query.