DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysD and SPACA3

DIOPT Version :9

Sequence 1:NP_476823.1 Gene:LysD / 38127 FlyBaseID:FBgn0004427 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_776246.1 Gene:SPACA3 / 124912 HGNCID:16260 Length:215 Species:Homo sapiens


Alignment Length:156 Identity:50/156 - (32%)
Similarity:73/156 - (46%) Gaps:28/156 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AFIVLVALAC---------AAPAFGRTMDRCSLAREMSNLGVPRDQ---LARWACIAEHESSYRT 55
            |.|:|:||.|         .|..:|    ||.|||.:.:.|:...:   ||.|.|:|...|.:..
Human    67 AGIMLLALVCLLSCLLPSSEAKLYG----RCELARVLHDFGLDGYRGYSLADWVCLAYFTSGFNA 127

  Fly    56 GVVGPENYNGSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVLSQ-QG 119
            ..:..| .:||.:.||||||...||:..:.... |.|.:.|:.||..::..:|.||.|:..: ||
Human   128 AALDYE-ADGSTNNGIFQINSRRWCSNLTPNVP-NVCRMYCSDLLNPNLKDTVICAMKITQEPQG 190

  Fly   120 WSAWSTW-HYCSG-----WLPSIDDC 139
            ...|..| |:|.|     |   :|.|
Human   191 LGYWEAWRHHCQGKDLTEW---VDGC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysDNP_476823.1 LYZ_C_invert 19..139 CDD:381618 41/129 (32%)
SPACA3NP_776246.1 LYZ_C 88..213 CDD:340383 42/133 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153962
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8437
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.