DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysB and LYZL1

DIOPT Version :9

Sequence 1:NP_001261245.1 Gene:LysB / 38125 FlyBaseID:FBgn0004425 Length:140 Species:Drosophila melanogaster
Sequence 2:XP_005252684.1 Gene:LYZL1 / 84569 HGNCID:30502 Length:185 Species:Homo sapiens


Alignment Length:130 Identity:49/130 - (37%)
Similarity:72/130 - (55%) Gaps:9/130 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIVLVAL-ALAAPALGRTMDRCSLAREMSNLGVPR---DQLARWACIAEHESSYRTGVVGPE 61
            |||..:|..: .|...|..:...||.||:..|..|:..   ..|..|.|:|.:||.|.|......
Human    47 MKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVL 111

  Fly    62 NYNGSNDYGIFQINDYYWCAPPSGRF-SYNECGLSCNALLTDDITHSVRCAQKVLSQ-QGWSAWS 124
            : :||.||||||||.:.||.  .|:. ..|.|.::|:||:|||:|.::.||:|::.: ||.:.||
Human   112 D-DGSIDYGIFQINSFAWCR--RGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWS 173

  Fly   125  124
            Human   174  173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysBNP_001261245.1 Lys 19..139 CDD:278491 43/111 (39%)
LYZL1XP_005252684.1 LYZ1 66..172 CDD:238066 41/108 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153946
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8437
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.