DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysB and 9530003J23Rik

DIOPT Version :9

Sequence 1:NP_001261245.1 Gene:LysB / 38125 FlyBaseID:FBgn0004425 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_084182.2 Gene:9530003J23Rik / 77397 MGIID:1924647 Length:151 Species:Mus musculus


Alignment Length:135 Identity:53/135 - (39%)
Similarity:76/135 - (56%) Gaps:11/135 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIVLVALALAAPAL---GRTMDRCSLAREMSNLGVPRDQ---LARWACIAEHESSYRTGVV- 58
            |||.:.|:.|.|...::   |:..|||||||.:.:||:...|   ||.|.|:|:.||::.|... 
Mouse     1 MKAPLTLLTLGLLLLSITIQGKVYDRCSLARTLQSLGLAGFQGITLANWVCLAKWESNFNTNTTR 65

  Fly    59 -GPENYNGSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVLSQ-QGWS 121
             .||:.  |..|||||||..:||.......|.|.|.:||.|||..:|..:|.||::::.. ||..
Mouse    66 FNPEDQ--STSYGIFQINSRFWCNDGKTPGSRNFCRISCKALLKSNIWSAVVCAKRIVKDPQGIY 128

  Fly   122 AWSTW 126
            :|:.|
Mouse   129 SWAGW 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysBNP_001261245.1 Lys 19..139 CDD:278491 46/114 (40%)
9530003J23RikNP_084182.2 LYZ1 22..147 CDD:238066 46/114 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844162
Domainoid 1 1.000 108 1.000 Domainoid score I6421
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4836
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8677
orthoMCL 1 0.900 - - OOG6_107030
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.810

Return to query results.
Submit another query.