DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysB and Lyzl6

DIOPT Version :9

Sequence 1:NP_001261245.1 Gene:LysB / 38125 FlyBaseID:FBgn0004425 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001343401.1 Gene:Lyzl6 / 69444 MGIID:1916694 Length:148 Species:Mus musculus


Alignment Length:145 Identity:51/145 - (35%)
Similarity:70/145 - (48%) Gaps:16/145 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIVLVALALAAPALGRTMDRCSLAR---EMSNLGVPRDQLARWACIAEHESSYRTGVVGPEN 62
            :||..:.||..|.....|..:.|||||:   |....|.....|..|.|:|..||::....|. ||
Mouse     2 LKALFICVASCLLVVNDGNIIHRCSLAKILYEEDLDGFEGYSLPDWLCLAFVESNFNISKVN-EN 65

  Fly    63 YNGSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVLSQQG----WSAW 123
            .:||.||||||||..|||...... |.|.|.:.|..||:.::..::.||:|::|..|    |..|
Mouse    66 VDGSFDYGIFQINSRYWCNDYQSH-SENFCHVDCQELLSPNLISTIHCAKKIVSGPGGMKNWVEW 129

  Fly   124 STWHYCSG-----WL 133
            ..  :|.|     |:
Mouse   130 KL--HCLGRPLSYWM 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysBNP_001261245.1 Lys 19..139 CDD:278491 45/127 (35%)
Lyzl6NP_001343401.1 LYZ1 21..142 CDD:238066 44/124 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844150
Domainoid 1 1.000 108 1.000 Domainoid score I6421
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4836
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8677
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.010

Return to query results.
Submit another query.