DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysB and Lyzl4

DIOPT Version :9

Sequence 1:NP_001261245.1 Gene:LysB / 38125 FlyBaseID:FBgn0004425 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001344275.2 Gene:Lyzl4 / 69032 MGIID:1916282 Length:145 Species:Mus musculus


Alignment Length:149 Identity:43/149 - (28%)
Similarity:74/149 - (49%) Gaps:17/149 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIVLVALA-LAAPALGRTMDRCSLAREMSNLGVPRDQ---LARWACIAEHESSYRTGVVGPE 61
            |:.::||:.:: |..|.....:.||::|:.:.:.|:...:   |..|.|:|..||.:....|..:
Mouse     1 MQLYLVLLLISYLLTPIGASILGRCTVAKMLYDGGLNYFEGYSLENWVCLAYFESKFNPSAVYED 65

  Fly    62 NYNGSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVL-SQQGWSAWST 125
            ..:||..:|:|||.|..||.  .|:   |.|.:||.|||..::..:::||:|:: .:.|..||..
Mouse    66 PQDGSTGFGLFQIRDNEWCG--HGK---NLCSVSCTALLNPNLKDTIQCAKKIVKGKHGMGAWPI 125

  Fly   126 W-------HYCSGWLPSID 137
            |       .....||...|
Mouse   126 WSKNCQLSDVLDRWLDGCD 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysBNP_001261245.1 Lys 19..139 CDD:278491 38/130 (29%)
Lyzl4NP_001344275.2 LYZ_C 21..143 CDD:340383 37/126 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844138
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.