DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysB and Lyc2

DIOPT Version :9

Sequence 1:NP_001261245.1 Gene:LysB / 38125 FlyBaseID:FBgn0004425 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001381322.1 Gene:Lyc2 / 688047 RGDID:1593616 Length:148 Species:Rattus norvegicus


Alignment Length:146 Identity:58/146 - (39%)
Similarity:80/146 - (54%) Gaps:16/146 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIVLVALALAAPALGRTMDRCSLAREMSN---LGVPRDQLARWACIAEHESSYRTGVVGPEN 62
            |||.:||..|.|:|....:....|.|||.:.:   .|.....|..|.|:|:|||::.|..:   |
  Rat     1 MKALLVLGFLLLSASVQAKVFKHCELARILRSSALAGYRGVSLENWMCMAQHESNFDTEAI---N 62

  Fly    63 YNG---SNDYGIFQINDYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVL-SQQGWSAW 123
            ||.   |.||||||||..|||.......:.|.||:.|:|||.||||.:::||::|: ..||..||
  Rat    63 YNSTDQSTDYGIFQINSRYWCNDGKTPRAVNACGIPCSALLQDDITQAIQCAKRVVRDPQGIRAW 127

  Fly   124 STW-HYC-----SGWL 133
            ..| .:|     ||::
  Rat   128 VAWQRHCQNRDLSGYI 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysBNP_001261245.1 Lys 19..139 CDD:278491 50/128 (39%)
Lyc2NP_001381322.1 LYZ1 19..147 CDD:197612 50/128 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347527
Domainoid 1 1.000 106 1.000 Domainoid score I6429
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I4799
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8912
orthoMCL 1 0.900 - - OOG6_107030
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.