DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysB and spaca5

DIOPT Version :10

Sequence 1:NP_523882.1 Gene:LysB / 38125 FlyBaseID:FBgn0004425 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001011312.1 Gene:spaca5 / 496769 XenbaseID:XB-GENE-923467 Length:140 Species:Xenopus tropicalis


Alignment Length:72 Identity:19/72 - (26%)
Similarity:37/72 - (51%) Gaps:4/72 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 ENEAILE-KVLNIYEKRLEESRFLACNSFT---LVDLHHLPNIQYLLGTPTKKLFEKRSKVRKWV 218
            |::.:|. ..|...:|.:.|...::|.:.|   ::.|.||.|::|||.:....:.||.:.|:.:.
 Frog   123 EDDCLLRLSQLENLQKTILEMEIISCGNITDKGIIALRHLRNLKYLLLSDLPGVREKENLVQAFK 187

  Fly   219 DEITSRE 225
            ..:.|.|
 Frog   188 TALPSLE 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysBNP_523882.1 LYZ_C_invert 19..139 CDD:381618
spaca5NP_001011312.1 LYZ_C 20..140 CDD:340383 4/16 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.