DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysB and MGC89221

DIOPT Version :9

Sequence 1:NP_001261245.1 Gene:LysB / 38125 FlyBaseID:FBgn0004425 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001004951.1 Gene:MGC89221 / 448362 XenbaseID:XB-GENE-5851163 Length:140 Species:Xenopus tropicalis


Alignment Length:139 Identity:53/139 - (38%)
Similarity:73/139 - (52%) Gaps:17/139 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIVLVALALAAPALGRTMDRCSLAREMSN---LGVPRDQLARWACIAEHESSYRTGVVGPEN 62
            ||.|::|:..| |..|....:||||:.|.:.|   :|:....|..:.|:|...|.|.|.:     
 Frog     1 MKIFVLLMITA-AFAAHSWALDRCSVVRAIRNGGVIGIKGYTLGDYVCLAYQASRYDTSL----- 59

  Fly    63 YNGS-NDYGIFQINDYYWCAPPSGRF--SYNECGLSCNALLTDDITHSVRCAQKVL-SQQGWSAW 123
             |.| .:|||||||.|:||  ..||.  ..|.||:||.:||..:|...|||.:::: ...|..||
 Frog    60 -NRSPTEYGIFQINSYWWC--DDGRTVGRKNLCGMSCRSLLNSNIGDDVRCLRRIVRDPNGLDAW 121

  Fly   124 STW-HYCSG 131
            |.| .||.|
 Frog   122 SVWTRYCKG 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysBNP_001261245.1 Lys 19..139 CDD:278491 46/121 (38%)
MGC89221NP_001004951.1 LYZ1 20..136 CDD:238066 46/119 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9324
Panther 1 1.100 - - O PTHR11407
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.